Seagoon_ to Melbourne · 7 months agoDaily Discussion Thread: 🤳📱↘️🚽 🤯 Wednesday, August 14, 2024message-squaremessage-square132fedilinkarrow-up118arrow-down12
arrow-up116arrow-down1message-squareDaily Discussion Thread: 🤳📱↘️🚽 🤯 Wednesday, August 14, 2024Seagoon_ to Melbourne · 7 months agomessage-square132fedilink
minus-squareunderwatermagpieslinkfedilinkarrow-up9·7 months agoMy late afternoon tea might have actually been dinner. Lemon meringue tart, delish. I’ll have some veggies tomorrow I promise.
minus-squareEaglelinkfedilinkarrow-up5·7 months agoDoes the line start behind you? because I need some now too.
minus-squareEaglelinkfedilinkarrow-up4·edit-27 months agoDon’t tell anyone, but there’s not much I wouldn’t do for lemon meringue pie… including conga-ing.
minus-squareSeagoon_OPlinkfedilinkarrow-up4·7 months agoevery time I think of these pies now, lemon, lime or peach, I think of that pie shop in Shape of Water. And I’ve had those American style pies. Weird. ( unlike real pies made with real ingredients , like fruit and sweet ricotta, real cream and home made sweet pastry )
minus-squareTheWitchofThornburylinkfedilinkEnglisharrow-up1·7 months agoLemons, sugar cane, wheat, all veggies … and eggs & butter for protein. You’re golden.
My late afternoon tea might have actually been dinner. Lemon meringue tart, delish.
I’ll have some veggies tomorrow I promise.
I need lemon meringue pie now.
Yes you do. It was great.
Does the line start behind you? because I need some now too.
We could make a conga line 💡
Don’t tell anyone, but there’s not much I wouldn’t do for lemon meringue pie… including conga-ing.
every time I think of these pies now, lemon, lime or peach, I think of that pie shop in Shape of Water. And I’ve had those American style pies. Weird.
( unlike real pies made with real ingredients , like fruit and sweet ricotta, real cream and home made sweet pastry )
Lemons, sugar cane, wheat, all veggies … and eggs & butter for protein. You’re golden.