BriongloidM to Melbourne · 3 days agoDaily Discussion Thread: Saturday, 22 February 2025message-squaremessage-square144fedilinkarrow-up115arrow-down10
arrow-up115arrow-down1message-squareDaily Discussion Thread: Saturday, 22 February 2025BriongloidM to Melbourne · 3 days agomessage-square144fedilink
minus-squareunderwatermagpieslinkfedilinkarrow-up11·3 days agoGood news: the fly that was buzzing around the room is dead. Bad news: it drowned in my cup of tea.
Good news: the fly that was buzzing around the room is dead.
Bad news: it drowned in my cup of tea.
extra protein